PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART04G22070.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 828aa    MW: 88283.7 Da    PI: 5.821
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART04G22070.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox70.81.6e-22121176156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe++F+++++p++++r+eL+k+lgL+ rqVk+WFqNrR+++k
  OBART04G22070.2 121 KKRYHRHTPQQIQELEAMFKECPHPDEKQRAELSKRLGLEPRQVKFWFQNRRTQMK 176
                      688999***********************************************998 PP

2START161.75.4e-513325662206
                      HHHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS......SCEEEEEEEECCSCH.HHHHHHHHCCCGGCT-TT-S.... CS
            START   2 laeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv.....dsgealrasgvvdmv.lallveellddkeqWdetla.... 77 
                      la +a++elvk+a+ ++p+W   +        es+n +e+l +f++  +     + +ea+r+sg+v+ +  a lve+l+d  ++W+ ++     
  OBART04G22070.2 332 LAMSAMDELVKMAQMGDPLWIPGAsvpsspakESLNFEEYLNTFPPCIGvkpegYVSEASRESGIVIIDdGAALVETLMDEVRRWSDMFScmia 425
                      67899***************9766667999****************9999**************998651568********************* PP

                      EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECT CS
            START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksn 159
                      ka+t+e is+g      gal lm+aelq+lsplvp R++ f+R+++ql +g+w++vdvS d+    +      s   + +++lpSg+++++++n
  OBART04G22070.2 426 KASTTEEISTGvagsrnGALLLMQAELQVLSPLVPiREVKFLRFSKQLADGVWAVVDVSADELMRDQGitsasSTANMNCRRLPSGCVLQDTPN 519
                      ************************************************************9987666666454555689*************** PP

                      CEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 160 ghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      g  kvtwveh++++++++h l+r+l++sgla ga +w atlqrqce+
  OBART04G22070.2 520 GFVKVTWVEHTEYDEASVHPLYRPLLRSGLALGAGRWIATLQRQCEC 566
                      *********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.36E-22105176IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-24107178IPR009057Homeodomain-like
PROSITE profilePS5007118.366118178IPR001356Homeobox domain
SMARTSM003893.2E-20119182IPR001356Homeobox domain
CDDcd000861.17E-20120176No hitNo description
PfamPF000467.7E-20121176IPR001356Homeobox domain
PRINTSPR000319.0E-5149158IPR000047Helix-turn-helix motif
PROSITE patternPS000270153176IPR017970Homeobox, conserved site
PRINTSPR000319.0E-5158174IPR000047Helix-turn-helix motif
PROSITE profilePS5084842.319322569IPR002913START domain
SuperFamilySSF559612.47E-23325566No hitNo description
CDDcd088751.53E-104326565No hitNo description
SMARTSM002342.8E-40331566IPR002913START domain
PfamPF018521.3E-42332566IPR002913START domain
SuperFamilySSF559611.79E-15586793No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 828 aa     Download sequence    Send to blast
MSFGVGDHFG DGVVPAGMQF PFSGAGPGVL TSSPALSLAL ADAVAGRNSG GGGKMVTAAH  60
GGVGGGGGGR AKARDALEVE NEISRSGSDH LDVVSCGDAG GGGGDDDDDE DAEHGNPPKR  120
KKRYHRHTPQ QIQELEAMFK ECPHPDEKQR AELSKRLGLE PRQVKFWFQN RRTQMKMQLE  180
RHENALLKQE NDKLRSENLS IREATSNAVC VGCGGPAMLG EVSLEEHHLR VENARLKDEL  240
SRVCALAARF LGKSISVMAP PQMHQPHPVR GSSLELAVGG IGSMPSATMP ISTITDFAGA  300
MSSSMGTVIT PMKSEAEPSA MAGIDKSLFL ELAMSAMDEL VKMAQMGDPL WIPGASVPSS  360
PAKESLNFEE YLNTFPPCIG VKPEGYVSEA SRESGIVIID DGAALVETLM DEVRRWSDMF  420
SCMIAKASTT EEISTGVAGS RNGALLLMQA ELQVLSPLVP IREVKFLRFS KQLADGVWAV  480
VDVSADELMR DQGITSASST ANMNCRRLPS GCVLQDTPNG FVKVTWVEHT EYDEASVHPL  540
YRPLLRSGLA LGAGRWIATL QRQCECLALL MSSIALPEND SSAIHPEGKR SMLKLARRMT  600
DNFCAGVSTS STREWSKLVG LTGNIGEDVH VMARKSVDEP GTPPGVVLSA ATSVWMPVMP  660
ERLFNFLHNK GLRAEWDILS NGGPMQEVTS IAKGQQNGNT SSVPLTKNFT VQPTKDKQNS  720
MLILQETCAD ASGSMVVYAP VDIPAMHLVM SGGDSSCVAL LPSGFAILPA GPSIGADHKM  780
GGSLLTVAFQ ILANSQPSAK LTVESVETVS NLISCTIKKI KTALHCDV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1119140.0AK111914.1 Oryza sativa Japonica Group cDNA clone:J033128F17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637147.10.0PREDICTED: homeobox-leucine zipper protein ROC4
SwissprotQ7Y0V90.0ROC4_ORYSJ; Homeobox-leucine zipper protein ROC4
TrEMBLA0A0D3FZ340.0A0A0D3FZ34_9ORYZ; Uncharacterized protein
STRINGBGIOSGA014527-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein